PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AS_4C4673A12.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 470aa    MW: 50835.7 Da    PI: 5.3805
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AS_4C4673A12.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-3988147261
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                            ++k+++cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+s
  Traes_3AS_4C4673A12.1  88 PDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGSMRNVPVGAGRRKSKNS 147
                            7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3085145IPR003851Zinc finger, Dof-type
PfamPF027017.8E-3290146IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.76192146IPR003851Zinc finger, Dof-type
PROSITE patternPS01361094130IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MKVDAPEEKE DGGMKGDELR ERKDDEMEVD APQAKQNAET ASSSTLDHKK DDQAQISNAE  60
EKVASDPKEE NEKKSNDESG QDKVLKKPDK IIPCPRCNSM DTKFCYYNNY NVNQPRHFCK  120
NCQRYWTAGG SMRNVPVGAG RRKSKNSALH YRQLLMAPDC LLGSRVDISD TVNPEVLASL  180
PSIPTQSASR NETVLKFGPE VPLCESMVSV LNIEEQNVTN AGSVPRDETR EGNSCASTTT  240
SNNGLPANAV PPGQNGAPVY CNGVGPVPQY YLGPPFMYPW SMGWNNLPVM VPGGSMPESA  300
SPSESCSTSS APWMNSPMMP GSRLPAPPFP YPIVPPALWG CLPSWPAAAW NTPWVGTNGC  360
ISPSGSSNSS CSGNGSPTLG KHSRDPNPQK DDKEEKSLWV PKTLRIDDPD EAAKSSIWAT  420
LGIKPGDPGV FKPFQFKGES KGQPADARPA RALQANPAAF SRSQSFQESS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565622.20.0PREDICTED: cyclic dof factor 2-like
TrEMBLW5CK460.0W5CK46_WHEAT; Uncharacterized protein
STRINGMLOC_56598.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-69cycling DOF factor 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]